PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G03340.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB_related
Protein Properties Length: 301aa    MW: 33843 Da    PI: 6.1758
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G03340.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.36.2e-173579147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rW++eE+e+++da  ++G + Wk+I +++  ++t  q++s+ qky
  LPERR01G03340.1 35 RERWSEEEHERFLDALIMYGRD-WKKIEEHVR-TKTTIQIRSHAQKY 79
                     78******************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.03E-182985IPR009057Homeodomain-like
PROSITE profilePS5129419.8993084IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.3E-93286IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-173382IPR006447Myb domain, plants
SMARTSM007179.1E-123482IPR001005SANT/Myb domain
PfamPF002491.5E-133579IPR001005SANT/Myb domain
CDDcd001678.87E-103780No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MDSSSNDSGN NNSSSSNSEM PGKKVRKPYT ITKPRERWSE EEHERFLDAL IMYGRDWKKI  60
EEHVRTKTTI QIRSHAQKYF LKVQKLGLAA GLPPQYPRRR LVMQQQQMQS SPAVSSTVAS  120
TAAILHGQPQ CLPLGMPHHN VNAAIQSSIG WDYMQNLDWG STSGSAAWVN HDSQIEPAIS  180
FPGESSFMWG TSFSNMSMDW TGGTSEMTTA STAHDEIELP LSPDDLQFAQ VYRFIGDIFD  240
PDTPCTVENH LQKLKNMDDI TVKTILVVLR NLEDNLLSTQ FEPIRRLLST YDPNQGLSGH  300
L
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1069691e-125AK106969.1 Oryza sativa Japonica Group cDNA clone:002-119-G02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646001.11e-158PREDICTED: protein REVEILLE 8
TrEMBLA0A0D9UWY50.0A0A0D9UWY5_9ORYZ; Uncharacterized protein
STRINGORGLA01G0032300.11e-167(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36423170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.14e-50MYB_related family protein